828255.com valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title N/A
Description N/A
Keywords N/A
Server Information
WebSite 828255 favicon www.828255.com
Host IP 103.28.248.28
Location Singapore
Related Websites
Site Rank
More to Explore
9800000.ru
abdulkerimbakir.com
abibcor.org
abo-salem.com
abpetclinic.com
abzarpishrafte.com
academielafayette.org
active-rest.ua
actividadesdeinfantilyprimaria.com
addicteddallas.com
blacknhung.com
broomevotes.com
828255.com Valuation
US$2,195
Last updated: Mar 21, 2020

828255.com has global traffic rank of 7,685,408. 828255.com has an estimated worth of US$ 2,195, based on its estimated Ads revenue. 828255.com receives approximately 400 unique visitors each day. Its web server is located in Singapore, with IP address 103.28.248.28. According to SiteAdvisor, 828255.com is unknown to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$2,195
Daily Ads Revenue US$1
Monthly Ads Revenue US$36
Yearly Ads Revenue US$439
Daily Unique Visitors 400
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 7,685,408
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
828255.com A 29 IP: 103.28.248.28
828255.com CNAME 599 null
HTTP Headers
HTTP/1.1 403 Forbidden
Content-Type: text/html
Cache-Control: no-cache
Connection: close
Content-Length: 848
X-Iinfo: 4-15462143-0 0NNN RT(1574544197717 0) q(0 -1 -1 1) r(2 -1) B16(4,289,0) U18
Set-Cookie: visid_incap_2030796=Z6HZcve6Rr6xhDBl9RYeSEWj2V0AAAAAQUIPAAAAAAB5kELKe+xlmA5I/M4f25EY; expires=Sun, 22 Nov 2020 12:19:56 GMT; path=/; Domain=.828255.com
Set-Cookie: incap_ses_894_2030796=Hz53Ot8gsF9Qul06IDJoDEWj2V0AAAAAaudp7Gn7VVqwBzwz7wUmBA==; path=/; Domain=.828255.com

828255.com Whois Information
   Domain Name: 828255.COM
   Registry Domain ID: 2288095020_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2019-05-29T08:25:04Z
   Creation Date: 2018-07-20T18:58:52Z
   Registry Expiry Date: 2021-07-20T18:58:52Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: abuse@godaddy.com
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: F1G1NS1.DNSPOD.NET
   Name Server: F1G1NS2.DNSPOD.NET
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: 828255.com
Registry Domain ID: 2288095020_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-29T08:17:20Z
Creation Date: 2018-07-20T18:58:52Z
Registrar Registration Expiration Date: 2021-07-20T18:58:52Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: 
Registrant State/Province: Fujian
Registrant Country: CN
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=828255.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=828255.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=828255.com
Name Server: F1G1NS1.DNSPOD.NET
Name Server: F1G1NS2.DNSPOD.NET
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/